PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400049312
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 241aa    MW: 27666.1 Da    PI: 8.4488
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400049312genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF991.9e-31959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krienk+nrqvtf+kRrng+lKKA+ELSvLCdae+a+iifss+gklye++s
  PGSC0003DMP400049312  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSSRGKLYEFCS 59
                          79***********************************************96 PP

2K-box96.25.2e-32801736100
                 K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                           g+ +++ ++++ +qe+ kLk+++e Lq++qRhllGedL++L  k+L+qLe+qL++sl++iRs+K++++l+q+ elq+ke++l e nk+L
  PGSC0003DMP400049312  80 GT-QTSPDSQNNYQEYLKLKARVEVLQQSQRHLLGEDLGQLGTKDLEQLERQLDSSLRQIRSTKTQHILDQLAELQQKEQSLTEMNKSL 167
                           44.567789******************************************************************************** PP

                 K-box  95 rkklee 100
                           r klee
  PGSC0003DMP400049312 168 RIKLEE 173
                           **9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.7E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.599161IPR002100Transcription factor, MADS-box
CDDcd002659.32E-45278No hitNo description
SuperFamilySSF554551.1E-33284IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-333859IPR002100Transcription factor, MADS-box
PfamPF014868.6E-2884171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.2687177IPR002487Transcription factor, K-box
Gene3DG3DSA:3.10.150.105.3E-5151216No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEIALIIFSS RGKLYEFCSN  60
SSISKTLERY HRYNYGTLEG TQTSPDSQNN YQEYLKLKAR VEVLQQSQRH LLGEDLGQLG  120
TKDLEQLERQ LDSSLRQIRS TKTQHILDQL AELQQKEQSL TEMNKSLRIK LEELGVAFQT  180
SWHSGEQSVQ YRHEQPSQHE GFFQHVNCNN TMPIRYDNVQ PENAAPSTHD AAGVVPGWML  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-289217122101Developmental protein SEPALLATA 3
4ox0_B3e-289217122101Developmental protein SEPALLATA 3
4ox0_C3e-289217122101Developmental protein SEPALLATA 3
4ox0_D3e-289217122101Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4485220.0AF448522.1 Lycopersicon esculentum MADS-box transcription factor MADS-RIN (MADS-RIN) mRNA, complete cds.
GenBankDQ1577960.0DQ157796.1 Lycopersicon esculentum cultivar Punjab Kesari MADS-box transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015075018.11e-175PREDICTED: MADS-box protein CMB1 isoform X2
SwissprotQ396851e-100CMB1_DIACA; MADS-box protein CMB1
TrEMBLM1CR521e-180M1CR52_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000728911e-178(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.22e-92MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]